PDB entry 1boa

View 1boa on RCSB PDB site
Description: human methionine aminopeptidase 2 complexed with angiogenesis inhibitor fumagillin
Deposited on 1998-08-01, released 1999-08-01
The last revision prior to the SCOP 1.65 freeze date was dated 1999-08-01, with a file datestamp of 1999-07-31.
Experiment type: XRAY
Resolution: 1.8 Å
R-factor: 0.193
AEROSPACI score: 0.52 (click here for full SPACI score report)

Chains and heterogens:

PDB Chain Sequences:

  • Chain ' ':
    Sequence, based on SEQRES records: (download)
    >1boa_ (-)
    magveevaasgshlngdldpddreegaastaeeaakkkrrkkkkskgpsaageqepdkes
    gasvdevarqlersaledkerdeddedgdgdgdgatgkkkkkkkkkrgpkvqtdppsvpi
    cdlypngvfpkgqeceypptqdgrtaawrttseekkaldqaseeiwndfreaaeahrqvr
    kyvmswikpgmtmieicekledcsrklikenglnaglafptgcslnncaahytpnagdtt
    vlqyddickidfgthisgriidcaftvtfnpkydtllkavkdatntgikcagidvrlcdv
    geaiqevmesyeveidgktyqvkpirnlnghsigqyrihagktvpiikggeatrmeegev
    yaietfgstgkgvvhddmecshymknfdvghvpirlprtkhllnvinenfgtlafcrrwl
    drlgeskylmalknlcdlgivdpypplcdikgsytaqfehtillrptckevvsrgddy
    

    Sequence, based on observed residues (ATOM records): (download)
    >1boa_ (-)
    kvqtdppsvpicdlypngvfpkgqeceypekkaldqaseeiwndfreaaeahrqvrkyvm
    swikpgmtmieicekledcsrklikenglnaglafptgcslnncaahytpnagdttvlqy
    ddickidfgthisgriidcaftvtfnpkydtllkavkdatntgikcagidvrlcdvgeai
    qevmesyeveidgktyqvkpirnlnghsigqyrihagktvpiikggeatrmeegevyaie
    tfgstgkgvvhddmecshymknfdvghvpirlprtkhllnvinenfgtlafcrrwldrlg
    eskylmalknlcdlgivdpypplcdikgsytaqfehtillrptckevvsrgddy