PDB entry 1bo9

View 1bo9 on RCSB PDB site
Description: nmr solution structure of domain 1 of human annexin I
Class: metal transport
Keywords: domain 1, metal transport
Deposited on 1998-08-10, released 1998-08-19
The last revision prior to the SCOPe 2.08 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.01 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: protein (annexin I)
  Species: Homo sapiens [TaxId:9606]
  Database cross-references and differences (RAF-indexed):
  • Uniprot P04083 (0-72)
  Domains in SCOPe 2.08: d1bo9a_

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1bo9A (A:)
  tfnpssdvaalhkaimvkgvdeatiidiltkrnnaqrqqikaaylqetgkpldetlkkal
  tghleevvlallk