PDB entry 1bo8

View 1bo8 on RCSB PDB site
Description: thymidylate synthase r178t mutant
Class: transferase
Keywords: transferase (methyltransferase), transferase, methyltransferase, nucleotide biosynthesis
Deposited on 1998-08-10, released 1998-08-19
The last revision prior to the SCOPe 2.07 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 2.4 Å
R-factor: 0.196
AEROSPACI score: 0.34 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: protein (thymidylate synthase)
    Species: Lactobacillus casei [TaxId:1582]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P00469 (0-315)
      • engineered (177)
    Domains in SCOPe 2.07: d1bo8a_
  • Heterogens: K, U, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1bo8A (A:)
    mleqpyldlakkvldeghfkpdrthtgtysifghqmrfdlskgfpllttkkvpfglikse
    llwflhgdtnirfllqhrnhiwdewafekwvksdeyhgpdmtdfghrsqkdpefaavyhe
    emakfddrvlhddafaakygdlglvygsqwrawhtskgdtidqlgdvieqikthpystrl
    ivsawnpedvptmalppchtlyqfyvndgklslqlyqrsadiflgvpfniasyallthlv
    ahecglevgefihtfgdahlyvnhldqikeqlsrtprpaptlqlnpdkhdifdfdmkdik
    llnydpypaikapvav