PDB entry 1bo6

View 1bo6 on RCSB PDB site
Description: estrogen sulfotransferase with inactive cofactor pap and vanadate
Deposited on 1998-08-10, released 1999-08-10
The last revision prior to the SCOP 1.63 freeze date was dated 1999-08-10, with a file datestamp of 1999-08-09.
Experiment type: XRAY
Resolution: 2.1 Å
R-factor: 0.207
AEROSPACI score: 0.4 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Domains in SCOP 1.63: d1bo6a_
  • Chain 'B':
    Domains in SCOP 1.63: d1bo6b_

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1bo6A (A:)
    peyyevfgefrgvlmdkrftkywedvemflarpddlviatypksgttwisevvymiykeg
    dvekckedaifnripylecrnedlingikqlkekesprivkthlppkllpasfweknckm
    iylcrnakdvavsyyyfllmitsypnpksfsefvekfmqgqvpygswydhvkawwekskn
    srvlfmfyedmkedirrevvklieflerkpsaelvdriiqhtsfqemknnpstnytmmpe
    emmnqkvspfmrkgiigdwknhfpealrerfdehykqqmkdctvkfrme
    

    Sequence, based on observed residues (ATOM records): (download)
    >1bo6A (A:)
    peyyevfgefrgvlmdkrftkywedvemflarpddlviatypksgttwisevvymiykeg
    daifnripylecrnedlingikqlkekesprivkthlppkllpasfweknckmiylcrna
    kdvavsyyyfllmitsypnpksfsefvekfmqgqvpygswydhvkawweksknsrvlfmf
    yedmkedirrevvklieflerkpsaelvdriiqhtsfqemknnpstnytmmpeemmnqkv
    spfmrkgiigdwknhfpealrerfdehykqqmkdctvkfrme
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1bo6B (B:)
    eyyevfgefrgvlmdkrftkywedvemflarpddlviatypksgttwisevvymiykegd
    vekckedaifnripylecrnedlingikqlkekesprivkthlppkllpasfweknckmi
    ylcrnakdvavsyyyfllmitsypnpksfsefvekfmqgqvpygswydhvkawwekskns
    rvlfmfyedmkedirrevvklieflerkpsaelvdriiqhtsfqemknnpstnytmmpee
    mmnqkvspfmrkgiigdwknhfpealrerfdehykqqmkdctvkfrme
    

    Sequence, based on observed residues (ATOM records): (download)
    >1bo6B (B:)
    eyyevfgefrgvlmdkrftkywedvemflarpddlviatypksgttwisevvymiykeke
    daifnripylecrnedlingikqlkekesprivkthlppkllpasfweknckmiylcrna
    kdvavsyyyfllmitsypnpksfsefvekfmqgqvpygswydhvkawweksknsrvlfmf
    yedmkedirrevvklieflerkpsaelvdriiqhtsfqemknnpstnytmmpeemmnqkv
    spfmrkgiigdwknhfpealrerfdehykqqmkdctvkfrme