PDB entry 1bo4

View 1bo4 on RCSB PDB site
Description: crystal structure of a gcn5-related n-acetyltransferase: serratia marescens aminoglycoside 3-n-acetyltransferase
Class: transferase
Keywords: aminoglycoside 3-n-acetyltransferase, eubacterial aminoglycoside resistance, gcn5-related n-acetyltransferase, coa-binding, transferase
Deposited on 1998-08-08, released 1998-10-07
The last revision prior to the SCOPe 2.07 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 2.3 Å
R-factor: 0.201
AEROSPACI score: 0.38 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: protein (serratia marcescens aminoglycoside-3-n-acetyltransferase)
    Species: Serratia marcescens [TaxId:615]
    Gene: AACC1
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1bo4a_
  • Chain 'B':
    Compound: protein (serratia marcescens aminoglycoside-3-n-acetyltransferase)
    Species: Serratia marcescens [TaxId:615]
    Gene: AACC1
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1bo4b_
  • Heterogens: SPD, COA, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1bo4A (A:)
    mlrssndvtqqgsrpktklggssmgiirtcrlgpdqvksmraaldlfgrefgdvatysqh
    qpdsdylgnllrsktfialaafdqeavvgalaayvlpkfeqprseiyiydlavsgehrrq
    giatalinllkheanalgayviyvqadygddpavalytklgireevmh
    

    Sequence, based on observed residues (ATOM records): (download)
    >1bo4A (A:)
    giirtcrlgpdqvksmraaldlfgrefgdvatysqhqpdsdylgnllrsktfialaafdq
    eavvgalaayvlpkfeqprseiyiydlavsgehrrqgiatalinllkheanalgayviyv
    qadygddpavalytklg
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1bo4B (B:)
    mlrssndvtqqgsrpktklggssmgiirtcrlgpdqvksmraaldlfgrefgdvatysqh
    qpdsdylgnllrsktfialaafdqeavvgalaayvlpkfeqprseiyiydlavsgehrrq
    giatalinllkheanalgayviyvqadygddpavalytklgireevmh
    

    Sequence, based on observed residues (ATOM records): (download)
    >1bo4B (B:)
    giirtcrlgpdqvksmraaldlfgrefgdvatysqhqpdsdylgnllrsktfialaafdq
    eavvgalaayvlpkfeqprseiyiydlavsgehrrqgiatalinllkheanalgayviyv
    qadygddpavalytkl