PDB entry 1bo1

View 1bo1 on RCSB PDB site
Description: phosphatidylinositol phosphate kinase type II beta
Class: transferase
Keywords: lipid signaling, transferase
Deposited on 1998-08-02, released 1998-10-07
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: XRAY
Resolution: 3 Å
R-factor: 0.229
AEROSPACI score: 0.21 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: protein (phosphatidylinositol phosphate kinase iibeta)
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1bo1a_
  • Chain 'B':
    Compound: protein (phosphatidylinositol phosphate kinase iibeta)
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1bo1b_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1bo1A (A:)
    mssnctsttavavaplsasktktkkkhfvcqkvklfrasepilsvlmwgvnhtinelsnv
    pvpvmlmpddfkayskikvdnhlfnkenlpsrfkfkeycpmvfrnlrerfgiddqdyqns
    vtrsapinsdsqgrcgtrflttydrrfviktvssedvaemhnilkkyhqfivechgntll
    pqflgmyrltvdgvetymvvtrnvfshrltvhrkydlkgstvareasdkekakdlptfkd
    ndflnegqklhvgeeskknfleklkrdveflaqlkimdysllvgihdvdraeqeemevee
    raedeecendgvggnllcsygtppdspgnllsfprffgpgefdpsvdvyamkshesspkk
    evyfmaiidiltpydtkkkaahaaktvkhgagaeistvnpeqyskrfnefmsnilt
    

    Sequence, based on observed residues (ATOM records): (download)
    >1bo1A (A:)
    klfrasepilsvlmwgvnhtinelsnvpvpvmlmpddfkayskikvdnhlfnkenlpsrf
    kfkeycpmvfrnlrerfgiddqdyqnsvtrsapinsdsqtrflttydrrfviktvssedv
    aemhnilkkyhqfivechgntllpqflgmyrltvdgvetymvvtrnvfshrltvhrkydl
    kgstvareasdkekakdlptfkdndflnegqklhvgeeskknfleklkrdveflaqlkim
    dysllvgihdvdraeqeemeveeraedeefdpsvdvyamkshesspkkevyfmaiidilt
    agaeistvnpeqyskrfnefmsnilt
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1bo1B (B:)
    mssnctsttavavaplsasktktkkkhfvcqkvklfrasepilsvlmwgvnhtinelsnv
    pvpvmlmpddfkayskikvdnhlfnkenlpsrfkfkeycpmvfrnlrerfgiddqdyqns
    vtrsapinsdsqgrcgtrflttydrrfviktvssedvaemhnilkkyhqfivechgntll
    pqflgmyrltvdgvetymvvtrnvfshrltvhrkydlkgstvareasdkekakdlptfkd
    ndflnegqklhvgeeskknfleklkrdveflaqlkimdysllvgihdvdraeqeemevee
    raedeecendgvggnllcsygtppdspgnllsfprffgpgefdpsvdvyamkshesspkk
    evyfmaiidiltpydtkkkaahaaktvkhgagaeistvnpeqyskrfnefmsnilt
    

    Sequence, based on observed residues (ATOM records): (download)
    >1bo1B (B:)
    frasepilsvlmwgvnhtinelsnvpvpvmlmpddfkayskikvdnhlfnkenlpsrfkf
    keycpmvfrnlrerfgiddqdyqnsvtrsapinsdsqgrcgtrflttydrrfviktvsse
    dvaemhnilkkyhqfivechgntllpqflgmyrltvdgvetymvvtrnvfshrltvhrky
    dlkgstvareasdkekakdlptfkdndflnegqklhvgeeskknfleklkrdveflaqlk
    imdysllvgihdvdraeqeemeveeraedpsvdvyamkshesspkkevyfmaiidilttv
    npeqyskrfnefmsnilt