PDB entry 1bnz

View 1bnz on RCSB PDB site
Description: sso7d hyperthermophile protein/DNA complex
Class: DNA binding protein/DNA
Keywords: protein-DNA interaction
Deposited on 1998-07-31, released 1998-11-11
The last revision prior to the SCOP 1.73 freeze date was dated 2003-04-01, with a file datestamp of 2007-06-04.
Experiment type: XRAY
Resolution: 2 Å
R-factor: 0.168
AEROSPACI score: 0.44 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: DNA-binding protein 7a
  Species: Sulfolobus acidocaldarius
  Database cross-references and differences (RAF-indexed):
  • Uniprot P80170 (1-63)
    • conflict (13)
  Domains in SCOP 1.73: d1bnza_
• Chain 'B':
  Compound: 5'-d(*gp*tp*ap*ap*tp*tp*ap*c)-3'
  
• Chain 'C':
  Compound: 5'-d(*gp*tp*ap*ap*tp*tp*ap*c)-3'
  
• Heterogens: HOH

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1bnzA (A:)
  matvkfkykgeekevdiskikkvwrvgkmisftydegggktgrgavsekdapkellqmle
  kqkk
  

  
  
• Chain 'B':
  No sequence available.
  
  
• Chain 'C':
  No sequence available.