PDB entry 1bnz

View 1bnz on RCSB PDB site
Description: sso7d hyperthermophile protein/DNA complex
Class: DNA binding protein/DNA
Keywords: protein-DNA interaction, DNA binding protein-DNA complex
Deposited on 1998-07-31, released 1998-11-11
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-10-04, with a file datestamp of 2017-09-29.
Experiment type: XRAY
Resolution: 2 Å
R-factor: N/A
AEROSPACI score: 0.3 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: DNA-binding protein 7a
    Species: Sulfolobus acidocaldarius [TaxId:2285]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P80170 (1-63)
      • conflict (13)
    Domains in SCOPe 2.07: d1bnza_
  • Chain 'B':
    Compound: 5'-d(*gp*tp*ap*ap*tp*tp*ap*c)-3'
  • Chain 'C':
    Compound: 5'-d(*gp*tp*ap*ap*tp*tp*ap*c)-3'
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1bnzA (A:)
    matvkfkykgeekevdiskikkvwrvgkmisftydegggktgrgavsekdapkellqmle
    kqkk
    

  • Chain 'B':
    No sequence available.

  • Chain 'C':
    No sequence available.