PDB entry 1bnx

View 1bnx on RCSB PDB site
Description: structural studies on the effects of the deletion in the red cell anion exchanger (band3, ae1) associated with south east asian ovalocytosis.
Class: electron transport
Keywords: human erythrocyte anion transporter, transmembrane, synthetic peptide, nmr, electron transport
Deposited on 1998-07-30, released 1998-08-05
The last revision prior to the SCOPe 2.08 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.02 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: protein (band 3)
  Species: synthetic, synthetic
  Database cross-references and differences (RAF-indexed):
  • Uniprot P02730 (0-32)
  Domains in SCOPe 2.08: d1bnxa_

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1bnxA (A:)
  rypyylsditdvifiyfaalspaitfggllgek