PDB entry 1bns

View 1bns on RCSB PDB site
Description: structural studies of barnase mutants
Deposited on 1994-04-11, released 1994-06-22
The last revision prior to the SCOP 1.55 freeze date was dated 1994-07-31, with a file datestamp of 1994-08-02.
Experiment type: -
Resolution: 2.05 Å
R-factor: 0.169
AEROSPACI score: 0.45 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Domains in SCOP 1.55: d1bnsa_
  • Chain 'B':
    Domains in SCOP 1.55: d1bnsb_
  • Chain 'C':
    Domains in SCOP 1.55: d1bnsc_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1bnsA (A:)
    vintfdgvadylqtyhklpdnyiakseaqalgwvaskgnladvapgksiggdifsnregk
    lpgksgrtwreadinytsgfrnsdrilyssdwliykttdhyqtftkir
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1bnsB (B:)
    vintfdgvadylqtyhklpdnyiakseaqalgwvaskgnladvapgksiggdifsnregk
    lpgksgrtwreadinytsgfrnsdrilyssdwliykttdhyqtftkir
    

  • Chain 'C':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1bnsC (C:)
    intfdgvadylqtyhklpdnyiakseaqalgwvaskgnladvapgksiggdifsnregkl
    pgksgrtwreadinytsgfrnsdrilyssdwliykttdhyqtftkir