PDB entry 1bnp

View 1bnp on RCSB PDB site
Description: nmr solution structure of the n-terminal domain of DNA polymerase beta, 55 structures
Class: nucleotidyltransferase (DNA-binding)
Keywords: n-terminal domain, DNA polymerase beta, single-stranded DNA-binding, nucleotidyltransferase, nucleotidyltransferase (DNA-binding)
Deposited on 1996-04-25, released 1996-12-07
The last revision prior to the SCOPe 2.08 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.01 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: DNA polymerase beta
  Species: Rattus norvegicus [TaxId:10116]
  Database cross-references and differences (RAF-indexed):
  • Uniprot P06766 (1-86)
  Domains in SCOPe 2.08: d1bnpa_

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1bnpA (A:)
  mskrkapqetlnggitdmlvelanfeknvsqaihkynayrkaasviakyphkiksgaeak
  klpgvgtkiaekideflatgklrklek