PDB entry 1bnl

View 1bnl on RCSB PDB site
Description: zinc dependent dimers observed in crystals of human endostatin
Class: extracellular matrix
Keywords: endostatin, collagen xviii, collagen, antiangiogenic, angiogenic, angiogenisis, cancer, zinc, extracellular matrix
Deposited on 1998-07-30, released 1998-10-14
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 2.9 Å
R-factor: 0.24
AEROSPACI score: 0.21 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: collagen xviii
    Species: Homo sapiens [TaxId:9606]
    Gene: COLLAGEN XVIII
    Database cross-references and differences (RAF-indexed):
    • Uniprot P39060 (0-177)
      • conflict (16)
    Domains in SCOPe 2.07: d1bnla_
  • Chain 'B':
    Compound: collagen xviii
    Species: Homo sapiens [TaxId:9606]
    Gene: COLLAGEN XVIII
    Database cross-references and differences (RAF-indexed):
    • Uniprot P39060 (0-177)
      • conflict (16)
    Domains in SCOPe 2.07: d1bnlb_
  • Chain 'C':
    Compound: collagen xviii
    Species: Homo sapiens [TaxId:9606]
    Gene: COLLAGEN XVIII
    Database cross-references and differences (RAF-indexed):
    • Uniprot P39060 (0-177)
      • conflict (16)
    Domains in SCOPe 2.07: d1bnlc_
  • Chain 'D':
    Compound: collagen xviii
    Species: Homo sapiens [TaxId:9606]
    Gene: COLLAGEN XVIII
    Database cross-references and differences (RAF-indexed):
    • Uniprot P39060 (0-177)
      • conflict (16)
    Domains in SCOPe 2.07: d1bnld_
  • Heterogens: ZN

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1bnlA (A:)
    hshrdfqpvlhlvalnaplsggmrgirgadfqcfqqaravglagtfraflssrlqdlysi
    vrradraavpivnlkdellfpswealfsgsegplkpgarifsfdgkdvlrhptwpqksvw
    hgsdpngrrltesycetwrteapsatgqassllggrllgqsaaschhayivlciensf
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1bnlB (B:)
    hshrdfqpvlhlvalnaplsggmrgirgadfqcfqqaravglagtfraflssrlqdlysi
    vrradraavpivnlkdellfpswealfsgsegplkpgarifsfdgkdvlrhptwpqksvw
    hgsdpngrrltesycetwrteapsatgqassllggrllgqsaaschhayivlciensf
    

  • Chain 'C':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1bnlC (C:)
    hshrdfqpvlhlvalnaplsggmrgirgadfqcfqqaravglagtfraflssrlqdlysi
    vrradraavpivnlkdellfpswealfsgsegplkpgarifsfdgkdvlrhptwpqksvw
    hgsdpngrrltesycetwrteapsatgqassllggrllgqsaaschhayivlciensf
    

  • Chain 'D':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1bnlD (D:)
    hshrdfqpvlhlvalnaplsggmrgirgadfqcfqqaravglagtfraflssrlqdlysi
    vrradraavpivnlkdellfpswealfsgsegplkpgarifsfdgkdvlrhptwpqksvw
    hgsdpngrrltesycetwrteapsatgqassllggrllgqsaaschhayivlciensf