PDB entry 1bnk

View 1bnk on RCSB PDB site
Description: human 3-methyladenine DNA glycosylase complexed to DNA
Class: hydrolase/DNA
Keywords: DNA repair, DNA glycosylase, hydrolase/DNA complex
Deposited on 1998-07-29, released 1998-10-21
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: XRAY
Resolution: 2.7 Å
R-factor: 0.216
AEROSPACI score: 0.28 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: protein (3-methyladenine DNA glycosylase)
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1bnka_
  • Chain 'D':
    Compound: DNA (5'-d(*gp*ap*cp*ap*tp*gp*yrrp*tp*tp*gp*cp*cp*t)-3')
  • Chain 'E':
    Compound: DNA (5'-d(*gp*gp*cp*ap*ap*tp*cp*ap*tp*gp*tp*cp*a)-3')
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1bnkA (A:)
    kghltrlgleffdqpavplaraflgqvlvrrlpngtelrgriveteaylgpedeaahsrg
    grqtprnrgmfmkpgtlyvyiiygmyfcmnissqgdgacvllraleplegletmrhvrsq
    lrkgtasrvlkdrelcsgpsklcqalainksfdqrdlaqdeavwlergplepsepavvaa
    arvgvghagewarkplrfyvrgspwvsvvdrvaeqd
    

    Sequence, based on observed residues (ATOM records): (download)
    >1bnkA (A:)
    kghltrlgleffdqpavplaraflgqvlvrrlpngtelrgriveteaylgpedeaahsrg
    grqtprnrgmfmkpgtlyvyiiygmyfcmnissqgdgacvllraleplegletmrqlrsr
    vlkdrelcsgpsklcqalainksfdqrdlaqdeavwleravvaaarvgvghagewarkpl
    rfyvrgspwvsvvdrvaeqd
    

  • Chain 'D':
    No sequence available.

  • Chain 'E':
    No sequence available.