PDB entry 1bnj

View 1bnj on RCSB PDB site
Description: barnase wildtype structure at ph 9.0
Deposited on 1995-05-17, released 1995-09-15
The last revision prior to the SCOP 1.55 freeze date was dated 1995-09-15, with a file datestamp of 1995-09-15.
Experiment type: XRAY
Resolution: 2.1 Å
R-factor: 0.159
AEROSPACI score: 0.45 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Domains in SCOP 1.55: d1bnja_
  • Chain 'B':
    Domains in SCOP 1.55: d1bnjb_
  • Chain 'C':
    Domains in SCOP 1.55: d1bnjc_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1bnjA (A:)
    qvintfdgvadylqtyhklpdnyitkseaqalgwvaskgnladvapgksiggdifsnreg
    klpgksgrtwreadinytsgfrnsdrilyssdwliykttdhyqtftkir
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1bnjB (B:)
    vintfdgvadylqtyhklpdnyitkseaqalgwvaskgnladvapgksiggdifsnregk
    lpgksgrtwreadinytsgfrnsdrilyssdwliykttdhyqtftkir
    

  • Chain 'C':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1bnjC (C:)
    intfdgvadylqtyhklpdnyitkseaqalgwvaskgnladvapgksiggdifsnregkl
    pgksgrtwreadinytsgfrnsdrilyssdwliykttdhyqtftkir