PDB entry 1bnh

View 1bnh on RCSB PDB site
Description: crystal structure of porcine ribonuclease inhibitor, a protein with leucine-rich repeats
Deposited on 1994-01-20, released 1994-04-30
The last revision was dated 1994-04-30, with a file datestamp of 2007-04-25.
Experiment type: XRAY
Resolution: 2.3 Å
R-factor: 0.209
AEROSPACI score: 0.33 (click here for full SPACI score report)

Chains and heterogens:

  • Chain ' ':
    no info in PDB for this chain
  • Chain 'p':
    no info in PDB for this chain

PDB Chain Sequences:
This PDB entry is not classified in SCOPe 2.07, so the chain sequences below are not included in the ASTRAL sequence sets.

  • Chain ' ':
    Sequence; same for both SEQRES and ATOM records:
    >1bnh_ (-)
    mnldihceqlsdarwtellpllqqyevvrlddcglteehckdigsalranpsltelclrt
    nelgdagvhlvlqglqsptckiqklslqncslteagcgvlpstlrslptlrelhlsdnpl
    gdaglrllceglldpqchleklqleycrltaasceplasvlratralkeltvsnndigea
    garvlgqgladsacqletlrlencgltpanckdlcgivasqaslreldlgsnglgdagia
    elcpgllspasrlktlwlwecditasgcrdlcrvlqaketlkelslagnklgdegarllc
    esllqpgcqleslwvkscsltaaccqhvslmltqnkhllelqlssnklgdsgiqelcqal
    sqpgttlrvlclgdcevtnsgcsslaslllanrslreldlsnncvgdpgvlqllgsleqp
    gcaleqlvlydtywteevedrlqalegskpglrvis
    

  • Chain 'p':
    No sequence available.