PDB entry 1bng

View 1bng on RCSB PDB site
Description: barnase s85c/h102c disulfide mutant
Deposited on 1995-03-31, released 1995-07-10
The last revision prior to the SCOP 1.55 freeze date was dated 1995-07-10, with a file datestamp of 1995-07-11.
Experiment type: XRAY
Resolution: 2.1 Å
R-factor: 0.17
AEROSPACI score: 0.44 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Domains in SCOP 1.55: d1bnga_
  • Chain 'B':
    Domains in SCOP 1.55: d1bngb_
  • Chain 'C':
    Domains in SCOP 1.55: d1bngc_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1bngA (A:)
    vintfdgvadylqtyhklpdnyitkseaqalgwvaskgnladvapgksiggdifsnregk
    lpgksgrtwreadinytsgfrncdrilyssdwliykttdcyqtftkir
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1bngB (B:)
    intfdgvadylqtyhklpdnyitkseaqalgwvaskgnladvapgksiggdifsnregkl
    pgksgrtwreadinytsgfrncdrilyssdwliykttdcyqtftkir
    

  • Chain 'C':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1bngC (C:)
    intfdgvadylqtyhklpdnyitkseaqalgwvaskgnladvapgksiggdifsnregkl
    pgksgrtwreadinytsgfrncdrilyssdwliykttdcyqtftkir