PDB entry 1bne

View 1bne on RCSB PDB site
Description: barnase a43c/s80c disulfide mutant
Class: endonuclease
Keywords: endonuclease
Deposited on 1995-03-31, released 1995-07-10
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-11.
Experiment type: XRAY
Resolution: 2.1 Å
R-factor: 0.169
AEROSPACI score: 0.42 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: barnase
    Species: Bacillus amyloliquefaciens [TaxId:1390]
    Gene: BARNASE
    Database cross-references and differences (RAF-indexed):
    • Uniprot P00648 (Start-109)
      • conflict (42)
      • conflict (79)
    Domains in SCOPe 2.07: d1bnea_
  • Chain 'B':
    Compound: barnase
    Species: Bacillus amyloliquefaciens [TaxId:1390]
    Gene: BARNASE
    Database cross-references and differences (RAF-indexed):
    • Uniprot P00648 (Start-109)
      • conflict (42)
      • conflict (79)
    Domains in SCOPe 2.07: d1bneb_
  • Chain 'C':
    Compound: barnase
    Species: Bacillus amyloliquefaciens [TaxId:1390]
    Gene: BARNASE
    Database cross-references and differences (RAF-indexed):
    • Uniprot P00648 (Start-109)
      • conflict (42)
      • conflict (79)
    Domains in SCOPe 2.07: d1bnec_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1bneA (A:)
    aqvintfdgvadylqtyhklpdnyitkseaqalgwvaskgnlcdvapgksiggdifsnre
    gklpgksgrtwreadinytcgfrnsdrilyssdwliykttdhyqtftkir
    

    Sequence, based on observed residues (ATOM records): (download)
    >1bneA (A:)
    vintfdgvadylqtyhklpdnyitkseaqalgwvaskgnlcdvapgksiggdifsnregk
    lpgksgrtwreadinytcgfrnsdrilyssdwliykttdhyqtftkir
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1bneB (B:)
    aqvintfdgvadylqtyhklpdnyitkseaqalgwvaskgnlcdvapgksiggdifsnre
    gklpgksgrtwreadinytcgfrnsdrilyssdwliykttdhyqtftkir
    

    Sequence, based on observed residues (ATOM records): (download)
    >1bneB (B:)
    vintfdgvadylqtyhklpdnyitkseaqalgwvaskgnlcdvapgksiggdifsnregk
    lpgksgrtwreadinytcgfrnsdrilyssdwliykttdhyqtftkir
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >1bneC (C:)
    aqvintfdgvadylqtyhklpdnyitkseaqalgwvaskgnlcdvapgksiggdifsnre
    gklpgksgrtwreadinytcgfrnsdrilyssdwliykttdhyqtftkir
    

    Sequence, based on observed residues (ATOM records): (download)
    >1bneC (C:)
    vintfdgvadylqtyhklpdnyitkseaqalgwvaskgnlcdvapgksiggdifsnregk
    lpgksgrtwreadinytcgfrnsdrilyssdwliykttdhyqtftkir