PDB entry 1bnd

View 1bnd on RCSB PDB site
Description: structure of the brain-derived neurotrophic factor(slash)neurotrophin 3 heterodimer
Class: complex (growth factor/growth factor)
Keywords: neurotrophin
Deposited on 1994-12-12, released 1996-04-04
The last revision prior to the SCOP 1.75 freeze date was dated 2003-04-01, with a file datestamp of 2007-06-04.
Experiment type: XRAY
Resolution: 2.3 Å
R-factor: 0.182
AEROSPACI score: 0.4 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: brain derived neurotrophic factor
    Species: HOMO SAPIENS
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.75: d1bnda_
  • Chain 'B':
    Compound: neurotrophin 3
    Species: HOMO SAPIENS
    Database cross-references and differences (RAF-indexed):
    • Uniprot P20783
      • conflict (10)
      • conflict (43)
    Domains in SCOP 1.75: d1bndb_
  • Heterogens: IPA, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1bndA (A:)
    hsdparrgqlsvcdsisewvtaadkktavdmsggtvtvlekvpvskgqlkqyfyetkcnp
    mgytkegcrgidkrhwnsqcrttqsyvraltmdskkrigwrfiridtscvctltikrgr
    

    Sequence, based on observed residues (ATOM records): (download)
    >1bndA (A:)
    gqlsvcdsisewvtaadkktavdmsggtvtvlekvpvskgqlkqyfyetkcnpmgytkeg
    crgidkrhwnsqcrttqsyvraltmdskkrigwrfiridtscvctltik
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1bndB (B:)
    yaehkshrgevsvcdseslwvtdkssaidirghqvtvlgeiktqnspvkqyfyetrckea
    rpvkngcrgiddkhwnsqcktsqtyvraltsennklvgwrwiridtscvcalsrkigrt
    

    Sequence, based on observed residues (ATOM records): (download)
    >1bndB (B:)
    rgevsvcdseslwvtdkssaidirghqvtvlgeiktqnspvkqyfyetrckearpvkngc
    rgiddkhwnsqcktsqtyvraltsennklvgwrwiridtscvcalsrk