PDB entry 1bnd

View 1bnd on RCSB PDB site
Description: structure of the brain-derived neurotrophic factor(slash)neurotrophin 3 heterodimer
Deposited on 1994-12-12, released 1996-04-04
The last revision prior to the SCOP 1.57 freeze date was dated 1996-04-04, with a file datestamp of 1996-04-11.
Experiment type: XRAY
Resolution: 2.3 Å
R-factor: 0.182
AEROSPACI score: 0.37 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Domains in SCOP 1.57: d1bnda_
  • Chain 'B':
    Domains in SCOP 1.57: d1bndb_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1bndA (A:)
    gqlsvcdsisewvtaadkktavdmsggtvtvlekvpvskgqlkqyfyetkcnpmgytkeg
    crgidkrhwnsqcrttqsyvraltmdskkrigwrfiridtscvctltik
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1bndB (B:)
    rgevsvcdseslwvtdkssaidirghqvtvlgeiktqnspvkqyfyetrckearpvkngc
    rgiddkhwnsqcktsqtyvraltsennklvgwrwiridtscvcalsrk