PDB entry 1bnc

View 1bnc on RCSB PDB site
Description: three-dimensional structure of the biotin carboxylase subunit of acetyl-coa carboxylase
Deposited on 1994-07-06, released 1995-08-30
The last revision prior to the SCOP 1.55 freeze date was dated 1995-08-30, with a file datestamp of 1995-09-04.
Experiment type: XRAY
Resolution: 2.4 Å
R-factor: 0.183
AEROSPACI score: 0.33 (click here for full SPACI score report)

Chains and heterogens:

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1bncA (A:)
    mldkivianrgeialrilrackelgiktvavhssadrdlkhvlladetvcigpapsvksy
    lnipaiisaaeitgavaihpgygflsenanfaeqversgfifigpkaetirlmgdkvsai
    aamkkagvpcvpgsdgplgddmdknraiakrigypviikasgggggrgmrvvrgdaelaq
    sismtraeakaafsndmvymekylenprhveiqvladgqgnaiylaerdcsmqrrhqkvv
    eeapapgitpelrryigercakacvdigyrgagtfeflfengefyfiemntriqvehpvt
    emitgvdlikeqlriaagqplsikqeevhvrghavecrinaedpntflpspgkitrfhap
    ggfgvrweshiyagytvppyydsmigklicygenrdvaiarmknalqeliidgiktnvdl
    qirimndenfqhggtnihylekklgl
    

    Sequence, based on observed residues (ATOM records): (download)
    >1bncA (A:)
    mldkivianrgeialrilrackelgiktvavhssadrdlkhvlladetvcigpapsvksy
    lnipaiisaaeitgavaihpgygflsenanfaeqversgfifigpkaetirlmgdkvsai
    aamkkagvpcvpgsdgplgddmdknraiakrigypviikrgmrvvrgdaelaqsismtra
    eakmvymekylenprhveiqvladgqgnaiylaerdcsmqrrhqkvveeapapgitpelr
    ryigercakacvdigyrgagtfeflfengefyfiemntriqvehpvtemitgvdlikeql
    riaagqplsikqeevhvrghavecrinaedpntflpspgkitrfhapggfgvrweshiya
    gytvppyydsmigklicygenrdvaiarmknalqeliidgiktnvdlqirimndenfqhg
    gtnihylekklgl
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1bncB (B:)
    mldkivianrgeialrilrackelgiktvavhssadrdlkhvlladetvcigpapsvksy
    lnipaiisaaeitgavaihpgygflsenanfaeqversgfifigpkaetirlmgdkvsai
    aamkkagvpcvpgsdgplgddmdknraiakrigypviikasgggggrgmrvvrgdaelaq
    sismtraeakaafsndmvymekylenprhveiqvladgqgnaiylaerdcsmqrrhqkvv
    eeapapgitpelrryigercakacvdigyrgagtfeflfengefyfiemntriqvehpvt
    emitgvdlikeqlriaagqplsikqeevhvrghavecrinaedpntflpspgkitrfhap
    ggfgvrweshiyagytvppyydsmigklicygenrdvaiarmknalqeliidgiktnvdl
    qirimndenfqhggtnihylekklglqe
    

    Sequence, based on observed residues (ATOM records): (download)
    >1bncB (B:)
    mldkivianrgeialrilrackelgiktvavhssadrdlkhvlladetvcigpapsvksy
    lnipaiisaaeitgavaihpgygflsenanfaeqversgfifigpkaetirlmgdkvsai
    aamkkagvpcvpgsdgddmdknraiakrigypviikrvvrgdaelaqsismtraymekyl
    enprhveiqvladgqgnaiylaerdcsmqrrhqkvveeapapgitpelrryigercakac
    vdigyrgagtfeflfengefyfiemntriqvehpvtemitgvdlikeqlriaagqplsik
    qeevhvrghavecrinaedpntflpspgkitrfhapggfgvrweshiyagytvppyydsm
    igklicygenrdvaiarmknalqeliidgiktnvdlqirimndenfqhggtnihylekkl
    glqe