PDB entry 1bnc

View 1bnc on RCSB PDB site
Description: three-dimensional structure of the biotin carboxylase subunit of acetyl-coa carboxylase
Class: fatty acid biosynthesis
Keywords: fatty acid biosynthesis
Deposited on 1994-07-06, released 1995-08-30
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-11-29, with a file datestamp of 2017-11-24.
Experiment type: XRAY
Resolution: 2.4 Å
R-factor: N/A
AEROSPACI score: 0.21 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: biotin carboxylase
    Species: Escherichia coli [TaxId:562]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1bnca1, d1bnca2, d1bnca3
  • Chain 'B':
    Compound: biotin carboxylase
    Species: Escherichia coli [TaxId:562]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1bncb1, d1bncb2, d1bncb3
  • Heterogens: PO4, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1bncA (A:)
    mldkivianrgeialrilrackelgiktvavhssadrdlkhvlladetvcigpapsvksy
    lnipaiisaaeitgavaihpgygflsenanfaeqversgfifigpkaetirlmgdkvsai
    aamkkagvpcvpgsdgplgddmdknraiakrigypviikasgggggrgmrvvrgdaelaq
    sismtraeakaafsndmvymekylenprhveiqvladgqgnaiylaerdcsmqrrhqkvv
    eeapapgitpelrryigercakacvdigyrgagtfeflfengefyfiemntriqvehpvt
    emitgvdlikeqlriaagqplsikqeevhvrghavecrinaedpntflpspgkitrfhap
    ggfgvrweshiyagytvppyydsmigklicygenrdvaiarmknalqeliidgiktnvdl
    qirimndenfqhggtnihylekklglqek
    

    Sequence, based on observed residues (ATOM records): (download)
    >1bncA (A:)
    mldkivianrgeialrilrackelgiktvavhssadrdlkhvlladetvcigpapsvksy
    lnipaiisaaeitgavaihpgygflsenanfaeqversgfifigpkaetirlmgdkvsai
    aamkkagvpcvpgsdgplgddmdknraiakrigypviikrgmrvvrgdaelaqsismtra
    eakmvymekylenprhveiqvladgqgnaiylaerdcsmqrrhqkvveeapapgitpelr
    ryigercakacvdigyrgagtfeflfengefyfiemntriqvehpvtemitgvdlikeql
    riaagqplsikqeevhvrghavecrinaedpntflpspgkitrfhapggfgvrweshiya
    gytvppyydsmigklicygenrdvaiarmknalqeliidgiktnvdlqirimndenfqhg
    gtnihylekklgl
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1bncB (B:)
    mldkivianrgeialrilrackelgiktvavhssadrdlkhvlladetvcigpapsvksy
    lnipaiisaaeitgavaihpgygflsenanfaeqversgfifigpkaetirlmgdkvsai
    aamkkagvpcvpgsdgplgddmdknraiakrigypviikasgggggrgmrvvrgdaelaq
    sismtraeakaafsndmvymekylenprhveiqvladgqgnaiylaerdcsmqrrhqkvv
    eeapapgitpelrryigercakacvdigyrgagtfeflfengefyfiemntriqvehpvt
    emitgvdlikeqlriaagqplsikqeevhvrghavecrinaedpntflpspgkitrfhap
    ggfgvrweshiyagytvppyydsmigklicygenrdvaiarmknalqeliidgiktnvdl
    qirimndenfqhggtnihylekklglqek
    

    Sequence, based on observed residues (ATOM records): (download)
    >1bncB (B:)
    mldkivianrgeialrilrackelgiktvavhssadrdlkhvlladetvcigpapsvksy
    lnipaiisaaeitgavaihpgygflsenanfaeqversgfifigpkaetirlmgdkvsai
    aamkkagvpcvpgsdgddmdknraiakrigypviikrvvrgdaelaqsismtraymekyl
    enprhveiqvladgqgnaiylaerdcsmqrrhqkvveeapapgitpelrryigercakac
    vdigyrgagtfeflfengefyfiemntriqvehpvtemitgvdlikeqlriaagqplsik
    qeevhvrghavecrinaedpntflpspgkitrfhapggfgvrweshiyagytvppyydsm
    igklicygenrdvaiarmknalqeliidgiktnvdlqirimndenfqhggtnihylekkl
    glqe