PDB entry 1bnb

View 1bnb on RCSB PDB site
Description: solution structure of bovine neutrophil beta-defensin 12: the peptide fold of the beta-defensins is identical to that of the classical defensins
Class: beta-defensin 12
Keywords: beta-defensin 12
Deposited on 1995-03-08, released 1995-10-15
The last revision prior to the SCOPe 2.08 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.01 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: bovine neutrophil beta-defensin 12
  Species: Bos taurus [TaxId:9913]
  Database cross-references and differences (RAF-indexed):
  • Uniprot P46170 (1-37)
  Domains in SCOPe 2.08: d1bnba_

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1bnbA (A:)
  aplscgrnggvcipircpvpmrqigtcfgrpvkccrsw