PDB entry 1bn7

View 1bn7 on RCSB PDB site
Description: haloalkane dehalogenase from a rhodococcus species
Class: hydrolase
Keywords: dehalogenase, alpha/beta-hydrolase, dhla, crystal structure
Deposited on 1998-07-31, released 2000-02-18
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 1.5 Å
R-factor: 0.158
AEROSPACI score: 0.67 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: haloalkane dehalogenase
    Species: Rhodococcus sp. [TaxId:1831]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P59336 (Start-292)
      • conflict (171)
      • conflict (208)
      • conflict (291)
    Domains in SCOPe 2.07: d1bn7a_
  • Heterogens: ACT, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1bn7A (A:)
    mseigtgfpfdphyvevlgermhyvdvgprdgtpvlflhgnptssylwrniiphvapshr
    ciapdligmgksdkpdldyffddhvryldafiealgleevvlvihdwgsalgfhwakrnp
    ervkgiacmefirpiptwdewpefaretfqafrtadvgreliidqnafiegvlpkcvvrp
    ltevemdhyrepflkpvdreplwrfpneipiagepanivalveaymnwlhqspvpkllfw
    gtpgvlippaeaarlaeslpncktvdigpglhylqednpdligseiarwlpgla
    

    Sequence, based on observed residues (ATOM records): (download)
    >1bn7A (A:)
    igtgfpfdphyvevlgermhyvdvgprdgtpvlflhgnptssylwrniiphvapshrcia
    pdligmgksdkpdldyffddhvryldafiealgleevvlvihdwgsalgfhwakrnperv
    kgiacmefirpiptwdewpefaretfqafrtadvgreliidqnafiegvlpkcvvrplte
    vemdhyrepflkpvdreplwrfpneipiagepanivalveaymnwlhqspvpkllfwgtp
    gvlippaeaarlaeslpncktvdigpglhylqednpdligseiarwlpgla