PDB entry 1bn5

View 1bn5 on RCSB PDB site
Description: human methionine aminopeptidase 2
Class: aminopeptidase
Keywords: methionine aminopeptidase, hydrolase
Deposited on 1998-07-31, released 1999-07-31
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 1.8 Å
R-factor: 0.183
AEROSPACI score: 0.54 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Methionine aminopeptidase
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P50579 (Start-477)
      • conflict (346)
    Domains in SCOPe 2.07: d1bn5a1, d1bn5a2
  • Heterogens: CO, TBU, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1bn5A (A:)
    magveevaasgshlngdldpddreegaastaeeaakkkrrkkkkskgpsaageqepdkes
    gasvdevarqlersaledkerdeddedgdgdgdgatgkkkkkkkkkrgpkvqtdppsvpi
    cdlypngvfpkgqeceypptqdgrtaawrttseekkaldqaseeiwndfreaaeahrqvr
    kyvmswikpgmtmieicekledcsrklikenglnaglafptgcslnncaahytpnagdtt
    vlqyddickidfgthisgriidcaftvtfnpkydtllkavkdatntgikcagidvrlcdv
    geaiqevmesyeveidgktyqvkpirnlnghsigqyrihagktvpiikggeatrmeegev
    yaietfgstgkgvvhddmecshymknfdvghvpirlprtkhllnvinenfgtlafcrrwl
    drlgeskylmalknlcdlgivdpypplcdikgsytaqfehtillrptckevvsrgddy
    

    Sequence, based on observed residues (ATOM records): (download)
    >1bn5A (A:)
    kvqtdppsvpicdlypngvfpkgqeceypeekkaldqaseeiwndfreaaeahrqvrkyv
    mswikpgmtmieicekledcsrklikenglnaglafptgcslnncaahytpnagdttvlq
    yddickidfgthisgriidcaftvtfnpkydtllkavkdatntgikcagidvrlcdvgea
    iqevmesyeveidgktyqvkpirnlnghsigqyrihagktvpiikggeatrmeegevyai
    etfgstgkgvvhddmecshymknfdvghvpirlprtkhllnvinenfgtlafcrrwldrl
    geskylmalknlcdlgivdpypplcdikgsytaqfehtillrptckevvsrgddy