PDB entry 1bn2

View 1bn2 on RCSB PDB site
Description: crystal structure of a bovine neurophysin /ii$ dipeptide complex at 2.8 angstroms determined from the single-wavelength anomalous scattering signal of an incorporated iodine atom
Deposited on 1990-08-07, released 1992-04-15
The last revision was dated 1999-02-16, with a file datestamp of 2007-04-25.
Experiment type: XRAY
Resolution: N/A
R-factor: N/A
AEROSPACI score: -0.3 (click here for full SPACI score report)

Chains and heterogens:

  • Chain '1':
    no info in PDB for this chain
  • Chain '2':
    no info in PDB for this chain
  • Chain '3':
    no info in PDB for this chain
  • Chain '4':
    no info in PDB for this chain
  • Chain '5':
    no info in PDB for this chain
  • Chain '6':
    no info in PDB for this chain
  • Chain '7':
    no info in PDB for this chain
  • Chain '8':
    no info in PDB for this chain
  • Chain '9':
    no info in PDB for this chain

PDB Chain Sequences:
This PDB entry is not classified in SCOPe 2.08, so the chain sequences below are not included in the ASTRAL sequence sets.

  • Chain '1':
    Sequence, based on SEQRES records:
    >1bn21 (1:)
    amsdlelrqclpcgpggkgrcfgpsiccgdelgcfvgtaealrcqeenylpspcqsgqkp
    cgsggrcaaagiccndescvtepecregvgfprrv
    

    Sequence, based on observed residues (ATOM records):
    >1bn21 (1:)
    amsdlelrqclpcgpggkgrcfgpsiccgdelgcfvgtaealrcqeenylpspcqsgqkp
    cgsggrcaaagiccndescvtepecr
    

  • Chain '2':
    Sequence, based on SEQRES records:
    >1bn22 (2:)
    amsdlelrqclpcgpggkgrcfgpsiccgdelgcfvgtaealrcqeenylpspcqsgqkp
    cgsggrcaaagiccndescvtepecregvgfprrv
    

    Sequence, based on observed residues (ATOM records):
    >1bn22 (2:)
    amsdlelrqclpcgpggkgrcfgpsiccgdelgcfvgtaealrcqeenylpspcqsgqkp
    cgsggrcaaagiccndescvtepecr
    

  • Chain '3':
    Sequence, based on SEQRES records:
    >1bn23 (3:)
    amsdlelrqclpcgpggkgrcfgpsiccgdelgcfvgtaealrcqeenylpspcqsgqkp
    cgsggrcaaagiccndescvtepecregvgfprrv
    

    Sequence, based on observed residues (ATOM records):
    >1bn23 (3:)
    amsdlelrqclpcgpggkgrcfgpsiccgdelgcfvgtaealrcqeenylpspcqsgqkp
    cgsggrcaaagiccndescvtepecr
    

  • Chain '4':
    Sequence, based on SEQRES records:
    >1bn24 (4:)
    amsdlelrqclpcgpggkgrcfgpsiccgdelgcfvgtaealrcqeenylpspcqsgqkp
    cgsggrcaaagiccndescvtepecregvgfprrv
    

    Sequence, based on observed residues (ATOM records):
    >1bn24 (4:)
    amsdlelrqclpcgpggkgrcfgpsiccgdelgcfvgtaealrcqeenylpspcqsgqkp
    cgsggrcaaagiccndescvtepecr
    

  • Chain '5':
    No sequence available.

  • Chain '6':
    No sequence available.

  • Chain '7':
    No sequence available.

  • Chain '8':
    No sequence available.

  • Chain '9':
    No sequence available.