PDB entry 1bmz

View 1bmz on RCSB PDB site
Description: human transthyretin (prealbumin)
Class: hormone/growth factor
Keywords: thyroxine transport, hormone/growth factor complex
Deposited on 1998-07-27, released 1998-08-05
The last revision prior to the SCOPe 2.03 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: XRAY
Resolution: 2 Å
R-factor: 0.183
AEROSPACI score: 0.45 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: protein (transthyretin)
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.03: d1bmza_
  • Chain 'B':
    Compound: protein (transthyretin)
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.03: d1bmzb_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1bmzA (A:)
    gptgtgeskcplmvkvldavrgspainvavhvfrkaaddtwepfasgktsesgelhgltt
    eeefvegiykveidtksywkalgispfhehaevvftandsgprrytiaallspysystta
    vvtnpke
    

    Sequence, based on observed residues (ATOM records): (download)
    >1bmzA (A:)
    cplmvkvldavrgspainvavhvfrkaaddtwepfasgktsesgelhgltteeefvegiy
    kveidtksywkalgispfhehaevvftandsgprrytiaallspysysttavvt
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1bmzB (B:)
    gptgtgeskcplmvkvldavrgspainvavhvfrkaaddtwepfasgktsesgelhgltt
    eeefvegiykveidtksywkalgispfhehaevvftandsgprrytiaallspysystta
    vvtnpke
    

    Sequence, based on observed residues (ATOM records): (download)
    >1bmzB (B:)
    cplmvkvldavrgspainvavhvfrkaaddtwepfasgktsesgelhgltteeefvegiy
    kveidtksywkalgispfhehaevvftandsgprrytiaallspysysttavvt