PDB entry 1bmz

View 1bmz on RCSB PDB site
Description: human transthyretin (prealbumin)
Deposited on 1998-07-27, released 1998-08-05
The last revision prior to the SCOP 1.55 freeze date was dated 2000-01-28, with a file datestamp of 2000-01-28.
Experiment type: XRAY
Resolution: 2 Å
R-factor: 0.183
AEROSPACI score: 0.45 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Domains in SCOP 1.55: d1bmza_
  • Chain 'B':
    Domains in SCOP 1.55: d1bmzb_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1bmzA (A:)
    cplmvkvldavrgspainvavhvfrkaaddtwepfasgktsesgelhgltteeefvegiy
    kveidtksywkalgispfhehaevvftandsgprrytiaallspysysttavvt
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1bmzB (B:)
    cplmvkvldavrgspainvavhvfrkaaddtwepfasgktsesgelhgltteeefvegiy
    kveidtksywkalgispfhehaevvftandsgprrytiaallspysysttavvt