PDB entry 1bmy

View 1bmy on RCSB PDB site
Description: human mrf-2 domain, nmr, 10 structures
Deposited on 1998-07-27, released 1999-07-27
The last revision was dated 2001-05-02, with a file datestamp of 2007-04-25.
Experiment type: NMR10
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.01 (click here for full SPACI score report)

Chains and heterogens:

  • Chain ' ':
    no info in PDB for this chain
  • Chain 'p':
    no info in PDB for this chain

PDB Chain Sequences:
This PDB entry is not classified in SCOPe 2.08, so the chain sequences below are not included in the ASTRAL sequence sets.

  • Chain ' ':
    Sequence; same for both SEQRES and ATOM records:
    >1bmy_ (-)
radeqaflvalykymkerktpieripylgfkqinlwtmfqaaqklggyetitarrqwkhi
ydelggnpgstsaatctrrhyerlilpyerfikgeedkplppikprk

  • Chain 'p':
    No sequence available.