PDB entry 1bmw

View 1bmw on RCSB PDB site
Description: A fibronectin type III fold in plant allergens: The solution structure of Phl PII from timothy grass pollen, NMR, 38 STRUCTURES
Class: allergen
Keywords: allergen, allergy, immunoglobulins, immunology, nmr
Deposited on 1998-07-27, released 1999-01-13
The last revision prior to the SCOPe 2.08 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.01 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: pollen allergen phl p2
    Species: Phleum pratense [TaxId:15957]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d1bmwa_

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download) 
    >1bmwA (A:)
vpkvtftvekgsnekhlavlvkyegdtmaevelrehgsdewvamtkgeggvwtfdseepl
qgpfnfrfltekgmknvfddvvpekytigatyapee

    Sequence, based on observed residues (ATOM records): (download) 
    >1bmwA (A:)
vpkvtftvekgsnekhlavlvkyegdtmaevelrehgsdewvamtkgeggvwtfdseepl
qgpfnfrfltekgmknvfddvvpekytigatyap