PDB entry 1bmv

View 1bmv on RCSB PDB site
Description: protein-RNA interactions in an icosahedral virus at 3.0 angstroms resolution
Class: Virus/RNA
Keywords: PROTEIN-RNA COMPLEX, SINGLE STRAND, Icosahedral virus, Virus/RNA COMPLEX
Deposited on 1989-10-09, released 1989-10-09
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-07.
Experiment type: XRAY
Resolution: 3 Å
R-factor: 0.33
AEROSPACI score: 0.04 (click here for full SPACI score report)

Chains and heterogens:

  • Chain '1':
    Compound: protein (icosahedral virus - a domain)
    Species: Bean pod mottle virus [TaxId:12260]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1bmv11
  • Chain '2':
    Compound: protein (icosahedral virus - b and c domain)
    Species: Bean pod mottle virus [TaxId:12260]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1bmv21, d1bmv22
  • Chain 'M':
    Compound: RNA (5'-r(*gp*gp*up*cp*ap*ap*ap*ap*up*gp*c)-3')

PDB Chain Sequences:

  • Chain '1':
    Sequence, based on SEQRES records: (download)
    >1bmv1 (1:)
    sisqqtvwnqmatvrtplnfdsskqsfcqfsvdllgggisvdktgdwitlvqnspisnll
    rvaawkkgclmvkvvmsgnaavkrsdwaslvqvfltnsnstehfdacrwtksephsweli
    fpievcgpnngfemwssewanqtswhlsflvdnpkqsttfdvllgisqnfeiagntlmpa
    fsvpqanarssenaessa
    

    Sequence, based on observed residues (ATOM records): (download)
    >1bmv1 (1:)
    sisqqtvwnqmatvrtplnfdsskqsfcqfsvdllgggisvdktgdwitlvqnspisnll
    rvaawkkgclmvkvvmsgnaavkrsdwaslvqvfltnsnstehfdacrwtksephsweli
    fpievcgpnngfemwssewanqtswhlsflvdnpkqsttfdvllgisqnfeiagntlmpa
    fsvpq
    

  • Chain '2':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1bmv2 (2:)
    metnlfklslddvetpkgsmldlkisqskialpkntvggtilrsdllanfltegnfrasv
    dlqrthrikgmikmvatvgipentgialacamnssirgrassdiyticsqdcelwnpact
    kamtmsfnpnpcsdawsleflkrtgfhcdiicvtgwtatpmqdvqvtidwfissqecvpr
    tycvlnpqnpfvlnrwmgkltfpqgtsrsvkrmplsigggagaksailmnmpnavlsmwr
    yfvgdlvfevskmtspyikctvsffiafgnladdtinfeafphklvqfgeiqekvvlkfs
    qeefltawstqvrpattlladgcpylyamvhdssvstipgdfvigvkltiienmcaygln
    pgisgsrllgtipq
    

  • Chain 'M':
    No sequence available.