PDB entry 1bmt

View 1bmt on RCSB PDB site
Description: how a protein binds b12: a 3.o angstrom x-ray structure of the b12-binding domains of methionine synthase
Class: methyltransferase
Keywords: methyltransferase
Deposited on 1994-09-02, released 1995-06-03
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 3 Å
R-factor: 0.17
AEROSPACI score: 0.25 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: methionine synthase
    Species: Escherichia coli [TaxId:562]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1bmta1, d1bmta2
  • Chain 'B':
    Compound: methionine synthase
    Species: Escherichia coli [TaxId:562]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1bmtb1, d1bmtb2
  • Heterogens: COB, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1bmtA (A:)
    qaewrswevnkrleyslvkgitefieqdteearqqatrpieviegplmdgmnvvgdlfge
    gkmflpqvvksarvmkqavaylepfieaskeqgktngkmviatvkgdvhdigknivgvvl
    qcnnyeivdlgvmvpaekilrtakevnadliglsglitpsldemvnvakemerqgftipl
    liggattskahtavkieqnysgptvyvqnasrtvgvvaallsdtqrddfvartrkeyetv
    riqhgr
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1bmtB (B:)
    qaewrswevnkrleyslvkgitefieqdteearqqatrpieviegplmdgmnvvgdlfge
    gkmflpqvvksarvmkqavaylepfieaskeqgktngkmviatvkgdvhdigknivgvvl
    qcnnyeivdlgvmvpaekilrtakevnadliglsglitpsldemvnvakemerqgftipl
    liggattskahtavkieqnysgptvyvqnasrtvgvvaallsdtqrddfvartrkeyetv
    riqhgr