PDB entry 1bms

View 1bms on RCSB PDB site
Description: crystal structure of ms2 capsids with mutations in the subunit fg loop
Class: Virus
Keywords: BACTERIOPHAGE COAT PROTEIN, Icosahedral virus
Deposited on 1995-08-29, released 1996-03-08
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-19.
Experiment type: XRAY
Resolution: 2.7 Å
R-factor: 0.218
AEROSPACI score: 0.28 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: bacteriophage ms2 capsid
    Species: Enterobacterio phage MS2 [TaxId:12022]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P03612 (0-128)
      • engineered (77)
    Domains in SCOPe 2.07: d1bmsa_
  • Chain 'B':
    Compound: bacteriophage ms2 capsid
    Species: Enterobacterio phage MS2 [TaxId:12022]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P03612 (0-128)
      • engineered (77)
    Domains in SCOPe 2.07: d1bmsb_
  • Chain 'C':
    Compound: bacteriophage ms2 capsid
    Species: Enterobacterio phage MS2 [TaxId:12022]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P03612 (0-128)
      • engineered (77)
    Domains in SCOPe 2.07: d1bmsc_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1bmsA (A:)
    asnftqfvlvdnggtgdvtvapsnfangvaewissnsrsqaykvtcsvrqssaqnrkyti
    kvevpkvatqtvggvelnvaawrsylnmeltipifatnsdcelivkamqgllkdgnpips
    aiaansgiy
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1bmsB (B:)
    asnftqfvlvdnggtgdvtvapsnfangvaewissnsrsqaykvtcsvrqssaqnrkyti
    kvevpkvatqtvggvelnvaawrsylnmeltipifatnsdcelivkamqgllkdgnpips
    aiaansgiy
    

  • Chain 'C':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1bmsC (C:)
    asnftqfvlvdnggtgdvtvapsnfangvaewissnsrsqaykvtcsvrqssaqnrkyti
    kvevpkvatqtvggvelnvaawrsylnmeltipifatnsdcelivkamqgllkdgnpips
    aiaansgiy