PDB entry 1bmr

View 1bmr on RCSB PDB site
Description: alpha-like toxin lqh III from scorpion leiurus quinquestriatus hebraeus, nmr, 25 structures
Class: toxin
Keywords: alpha-like toxin, scorpion toxin, sodium channel inhibitor
Deposited on 1998-07-24, released 1999-02-16
The last revision prior to the SCOPe 2.08 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.03 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: lqh III alpha-like toxin
    Species: Leiurus quinquestriatus hebraeus [TaxId:6884]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d1bmra_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1bmrA (A:)
    vrdgyiaqpencvyhcfpgssgcdtlckekggtsghcgfkvghglacwcnalpdnvgiiv
    egekchs