PDB entry 1bmq

View 1bmq on RCSB PDB site
Description: crystal structure of the complex of interleukin-1beta converting enzyme (ice) with a peptide based inhibitor, (3s )-n-methanesulfonyl-3-({1-[n-(2-naphtoyl)-l-valyl]-l-prolyl }amino)-4-oxobutanamide
Class: hydrolase
Keywords: caspase, hydrolase
Deposited on 1998-07-24, released 1998-07-29
The last revision prior to the SCOPe 2.08 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 2.5 Å
R-factor: 0.233
AEROSPACI score: 0.24 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: protein (interleukin-1 beta convertase)
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d1bmq.1
  • Chain 'B':
    Compound: protein (interleukin-1 beta convertase)
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d1bmq.1
  • Heterogens: MNO

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1bmqA (A:)
    gnvklcsleeaqriwkqksaeiypimdkssrtrlaliicneefdsiprrtgaevditgmt
    mllqnlgysvdvkknltasdmtteleafahrpehktsdstflvfmshgiregicgkkhse
    qvpdilqlnaifnmlntkncpslkdkpkviiiqacrgdspgvvwfkd
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1bmqB (B:)
    aikkahiekdfiafcsstpdnvswrhptmgsvfigrliehmqeyacscdveeifrkvrfs
    feqpdgraqmpttervtltrcfylfpgh