PDB entry 1bmo

View 1bmo on RCSB PDB site
Description: bm-40, fs/ec domain pair
Class: extracellular module
Keywords: extracellular module, glycoprotein, anti-adhesive protein
Deposited on 1997-03-25, released 1997-10-15
The last revision prior to the SCOP 1.73 freeze date was dated 1997-10-15, with a file datestamp of 2007-06-04.
Experiment type: XRAY
Resolution: 3.1 Å
R-factor: 0.262
AEROSPACI score: 0.17 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: bm-40
    Species: HOMO SAPIENS
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.73: d1bmoa1, d1bmoa2, d1bmoa3
  • Chain 'B':
    Compound: bm-40
    Species: HOMO SAPIENS
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.73: d1bmob1, d1bmob2, d1bmob3
  • Heterogens: CA

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1bmoA (A:)
    pcqnhhckhgkvceldenntpmcvcqdptscpapigefekvcsndnktfdsschffatkc
    tlegtkkghklhldyigpckyippcldseltefplrmrdwlknvlvtlyerdednnllte
    kqklrvkkihenekrleagdhpvellardfeknynmyifpvhwqfgqldqhpidgylsht
    elaplraplipmehcttrffetcdldndkyialdewagcfgikqkdidkdlvi
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1bmoB (B:)
    pcqnhhckhgkvceldenntpmcvcqdptscpapigefekvcsndnktfdsschffatkc
    tlegtkkghklhldyigpckyippcldseltefplrmrdwlknvlvtlyerdednnllte
    kqklrvkkihenekrleagdhpvellardfeknynmyifpvhwqfgqldqhpidgylsht
    elaplraplipmehcttrffetcdldndkyialdewagcfgikqkdidkdlvi