PDB entry 1bml

View 1bml on RCSB PDB site
Description: complex of the catalytic domain of human plasmin and streptokinase
Class: blood clotting
Keywords: human plasmin, streptokinase, blood clotting
Deposited on 1999-05-25, released 1999-08-02
The last revision prior to the SCOPe 2.08 freeze date was dated 2018-03-14, with a file datestamp of 2018-03-09.
Experiment type: XRAY
Resolution: 2.9 Å
R-factor: N/A
AEROSPACI score: 0.13 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: plasmin
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P00747 (0-249)
      • engineered mutation (199)
    Domains in SCOPe 2.08: d1bmla_
  • Chain 'B':
    Compound: plasmin
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P00747 (0-249)
      • engineered mutation (199)
    Domains in SCOPe 2.08: d1bmlb_
  • Chain 'C':
    Compound: Streptokinase
    Species: Streptococcus dysgalactiae subsp. equisimilis [TaxId:119602]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d1bmlc1, d1bmlc2, d1bmlc3
  • Chain 'D':
    Compound: Streptokinase
    Species: Streptococcus dysgalactiae subsp. equisimilis [TaxId:119602]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d1bmld1, d1bmld2, d1bmld3

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1bmlA (A:)
    aapsfdcgkpqvepkkcpgrvvggcvahphswpwqvslrtrfgmhfcggtlispewvlta
    ahcleksprpssykvilgahqevnlephvqeievsrlfleptrkdiallklsspavitdk
    vipaclpspnyvvadrtecfitgwgetqgtfgagllkeaqlpvienkvcnryeflngrvq
    stelcaghlaggtdscqgdaggplvcfekdkyilqgvtswglgcarpnkpgvyvrvsrfv
    twiegvmrnn
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1bmlB (B:)
    aapsfdcgkpqvepkkcpgrvvggcvahphswpwqvslrtrfgmhfcggtlispewvlta
    ahcleksprpssykvilgahqevnlephvqeievsrlfleptrkdiallklsspavitdk
    vipaclpspnyvvadrtecfitgwgetqgtfgagllkeaqlpvienkvcnryeflngrvq
    stelcaghlaggtdscqgdaggplvcfekdkyilqgvtswglgcarpnkpgvyvrvsrfv
    twiegvmrnn
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >1bmlC (C:)
    svnnsqlvvsvagtvegtnqdislkffeidltsrpahggkteqglspkskpfatdsgamp
    hklekadllkaiqeqlianvhsnddyfevidfasdatitdrngkvyfadkdgsvtlptqp
    vqefllsghvrvrpykekpiqnqaksvdveytvqftplnpdddfrpglkdtkllktlaig
    dtitsqellaqaqsilnkthpgytiyerdssivthdndifrtilpmdqeftyhvknreqa
    yeinkksglneeinntdlisekyyvlkkgekpydpfdrshlklftikyvdvntnellkse
    qlltasernldfrdlydprdkakllynnldafgimdytltgkvednhddtnriitvymgk
    rp
    

    Sequence, based on observed residues (ATOM records): (download)
    >1bmlC (C:)
    svnnsqlvvsvagtvegtnqdislkffeidltsrphklekadllkaiqeqlianvhsndd
    yfevidfasdatitdrngkvyfadkdgsvtlptqpvqefllsghvrvrpykekpiqnqak
    svdveytvqftplnpdddtkllktlaigdtitsqellaqaqsilnkthpgytiyerdssi
    vthdndifrtilpmdqeftyhvknreqaeinntdlisekyyvlkkgekpydpfdrshlkl
    ftikyvdvntnellkseqlltasernldfrdlydprdkakllynnldafgimdytltgkv
    ednhddtnriitvymgkr
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >1bmlD (D:)
    svnnsqlvvsvagtvegtnqdislkffeidltsrpahggkteqglspkskpfatdsgamp
    hklekadllkaiqeqlianvhsnddyfevidfasdatitdrngkvyfadkdgsvtlptqp
    vqefllsghvrvrpykekpiqnqaksvdveytvqftplnpdddfrpglkdtkllktlaig
    dtitsqellaqaqsilnkthpgytiyerdssivthdndifrtilpmdqeftyhvknreqa
    yeinkksglneeinntdlisekyyvlkkgekpydpfdrshlklftikyvdvntnellkse
    qlltasernldfrdlydprdkakllynnldafgimdytltgkvednhddtnriitvymgk
    rp
    

    Sequence, based on observed residues (ATOM records): (download)
    >1bmlD (D:)
    svnnsqlvvsvagtvegtnqdislkffeidltsrphklekadllkaiqeqlianvhsndd
    yfevidfasdatitdrngkvyfadkdgsvtlptqpvqefllsghvrvrpykekpiqnqak
    svdveytvqftplnpdddtkllktlaigdtitsqellaqaqsilnkthpgytiyerdssi
    vthdndifrtilpmdqeftyhvknreqaeinntdlisekyyvlkkgekpydpfdrshlkl
    ftikyvdvntnellkseqlltasernldfrdlydprdkakllynnldafgimdytltgkv
    ednhddtnriitvymgkr