PDB entry 1bmk

View 1bmk on RCSB PDB site
Description: the complex structure of the map kinase p38/sb218655
Class: transferase
Keywords: transferase, inhibitors, map kinase, serine/ threonine-protein kinase, p38
Deposited on 1998-07-23, released 1999-07-23
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-02-01, with a file datestamp of 2017-01-26.
Experiment type: XRAY
Resolution: 2.4 Å
R-factor: N/A
AEROSPACI score: 0.21 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: protein (map kinase p38)
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q16539
      • conflict (66)
      • conflict (281)
    Domains in SCOPe 2.07: d1bmka_
  • Heterogens: SB5, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1bmkA (A:)
    gsshhhhhhssglvprgshmsqerptfyrqelnktiwevperyqnlspvgsgaygsvcaa
    fdtktghrvavkklsrpfqsiihakrtyrelrllkhmkhenviglldvftparsleefnd
    vylvthlmgadlnnivkcqkltddhvqfliyqilrglkyihsadiihrdlkpsnlavned
    celkildfglarhtddemtgyvatrwyrapeimlnwmhynqtvdiwsvgcimaelltgrt
    lfpgtdhidqlklilrlvgtpgaellkkissesarnyiqslaqmpkmnfanvfiganpla
    vdllekmlvldsdkritaaqalahayfaqyhdpddepvadpydqsfesrdllidewkslt
    ydevisfvpppldqeemes
    

    Sequence, based on observed residues (ATOM records): (download)
    >1bmkA (A:)
    erptfyrqelnktiwevperyqnlspvgsgaygsvcaafdtktghrvavkklsrpfqsii
    hakrtyrelrllkhmkhenviglldvftparsleefndvylvthlmgadlnnivkcqklt
    ddhvqfliyqilrglkyihsadiihrdlkpsnlavnedcelkildfglarhtddemtgyv
    atrwyrapeimlnwmhynqtvdiwsvgcimaelltgrtlfpgtdhidqlklilrlvgtpg
    aellkkissesarnyiqslaqmpkmnfanvfiganplavdllekmlvldsdkritaaqal
    ahayfaqyhdpddepvadpydqsfesrdllidewksltydevisfvpppld