PDB entry 1bmi

View 1bmi on RCSB PDB site
Description: metallo-beta-lactamase
Class: beta-lactamase
Keywords: hydrolase, beta-lactamase, metallo beta-lactamase, zinc
Deposited on 1997-05-10, released 1997-07-23
The last revision prior to the SCOPe 2.07 freeze date was dated 2000-04-12, with a file datestamp of 2007-04-25.
Experiment type: XRAY
Resolution: 2 Å
R-factor: 0.196
AEROSPACI score: 0.43 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: metallo-beta-lactamase
    Species: BACTEROIDES FRAGILIS
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1bmia_
  • Chain 'B':
    Compound: metallo-beta-lactamase
    Species: BACTEROIDES FRAGILIS
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1bmib_
  • Heterogens: ZN, NA, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1bmiA (A:)
    aqksvkisddisitqlsdkvytyvslaeiegwgmvpsngmivinnhqaalldtpindaqt
    emlvnwvtdslhakvttfipnhwhgdcigglgylqrkgvqsyanqmtidlakekglpvpe
    hgftdsltvsldgmplqcyylggghatdnivvwlptenilfggcmlkdnqatsignisda
    dvtawpktldkvkakfpsaryvvpghgdyggteliehtkqivnqyiestskp
    

    Sequence, based on observed residues (ATOM records): (download)
    >1bmiA (A:)
    svkisddisitqlsdkvytyvslaeiegwgmvpsngmivinnhqaalldtpindaqteml
    vnwvtdslhakvttfipnhwhgdcigglgylqrkgvqsyanqmtidlakekglpvpehgf
    tdsltvsldgmplqcyylggghatdnivvwlptenilfggcmlkdnqatsignisdadvt
    awpktldkvkakfpsaryvvpghgdyggteliehtkqivnqyiestsk
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1bmiB (B:)
    aqksvkisddisitqlsdkvytyvslaeiegwgmvpsngmivinnhqaalldtpindaqt
    emlvnwvtdslhakvttfipnhwhgdcigglgylqrkgvqsyanqmtidlakekglpvpe
    hgftdsltvsldgmplqcyylggghatdnivvwlptenilfggcmlkdnqatsignisda
    dvtawpktldkvkakfpsaryvvpghgdyggteliehtkqivnqyiestskp
    

    Sequence, based on observed residues (ATOM records): (download)
    >1bmiB (B:)
    ksvkisddisitqlsdkvytyvslaeiegwgmvpsngmivinnhqaalldtpindaqtem
    lvnwvtdslhakvttfipnhwhgdcigglgylqrkgvqsyanqmtidlakekglpvpehg
    ftdsltvsldgmplqcyylggghatdnivvwlptenilfggcmlkdnqatsignisdadv
    tawpktldkvkakfpsaryvvpghgdyggteliehtkqivnqyiestskp