PDB entry 1bmg

View 1bmg on RCSB PDB site
Description: crystal structure of bovine beta2-microglobulin
Class: histocompatibility antigen
Keywords: lactollin, MHC-I histocompatibility antigen, light chain
Deposited on 1995-07-18, released 1995-10-15
The last revision prior to the SCOP 1.75 freeze date was dated 2003-04-01, with a file datestamp of 2007-06-28.
Experiment type: XRAY
Resolution: 2.5 Å
R-factor: 0.191
AEROSPACI score: 0.42 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: beta=2=-microglobulin
  Species: BOS TAURUS
  Database cross-references and differences (RAF-indexed):
  • Uniprot P01888 (0-97)
  Domains in SCOP 1.75: d1bmga_
• Heterogens: HOH

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1bmgA (A:)
  iqrppkiqvysrhppedgkpnylncyvygfhppqieidllkngekikseqsdlsfskdws
  fyllshaeftpnskdqyscrvkhvtleqprivkwdrdl