PDB entry 1bmg

View 1bmg on RCSB PDB site
Description: crystal structure of bovine beta2-microglobulin
Deposited on 1995-07-18, released 1995-10-15
The last revision prior to the SCOP 1.71 freeze date was dated 1995-10-15, with a file datestamp of 1995-10-16.
Experiment type: XRAY
Resolution: 2.5 Å
R-factor: 0.1914
AEROSPACI score: 0.32 (click here for full SPACI score report)

Chains and heterogens:

• Chain ' ':
  Domains in SCOP 1.71: d1bmg__

PDB Chain Sequences:

• Chain ' ':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1bmg_ (-)
  iqrppkiqvysrhppedgkpnylncyvygfhppqieidllkngekikseqsdlsfskdws
  fyllshaeftpnskdqyscrvkhvtleqprivkwdrdl