PDB entry 1bmg

View 1bmg on RCSB PDB site
Description: crystal structure of bovine beta2-microglobulin
Deposited on 1995-07-18, released 1995-10-15
The last revision prior to the SCOP 1.63 freeze date was dated 1995-10-15, with a file datestamp of 1995-10-16.
Experiment type: XRAY
Resolution: 2.5 Å
R-factor: 0.1914
AEROSPACI score: 0.33 (click here for full SPACI score report)

Chains and heterogens:

  • Chain ' ':
    Domains in SCOP 1.63: d1bmg__

PDB Chain Sequences:

  • Chain ' ':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1bmg_ (-)
    iqrppkiqvysrhppedgkpnylncyvygfhppqieidllkngekikseqsdlsfskdws
    fyllshaeftpnskdqyscrvkhvtleqprivkwdrdl