PDB entry 1bme

View 1bme on RCSB PDB site
Description: metallo-beta-lactamase from bacillus cereus 569/h/9
Deposited on 1997-05-10, released 1997-07-07
The last revision was dated 2000-04-12, with a file datestamp of 2007-04-25.
Experiment type: XRAY
Resolution: 1.85 Å
R-factor: 0.216
AEROSPACI score: 0.44 (click here for full SPACI score report)

Chains and heterogens:

  • Chain ' ':
    no info in PDB for this chain
  • Chain 'p':
    no info in PDB for this chain
  • Heterogens: ZN, BCT, HOH

PDB Chain Sequences:
This PDB entry is not classified in SCOPe 2.07, so the chain sequences below are not included in the ASTRAL sequence sets.

  • Chain ' ':
    Sequence, based on SEQRES records:
    >1bme_ (-)
    sqkvektviknetgtisisqlnknvwvhtelgsfngeavpsnglvlntskglvlvdsswd
    dkltkeliemvekkfqkrvtdviithahadriggiktlkergikahstaltaelakkngy
    eeplgdlqtvtnlkfgnmkvetfypgkghtednivvwlpqynilvggclvkstsakdlgn
    vadayvnewstsienvlkryrninavvpghgevgdkglllhtldllk
    

    Sequence, based on observed residues (ATOM records):
    >1bme_ (-)
    tviknetgtisisqlnknvwvhtelgsfngeavpsnglvlntskglvlvdsswddkltke
    liemvekkfqkrvtdviithahadriggiktlkergikahstaltaelakkngyeeplgd
    lqtvtnlkfgnmkvetfypgkghtednivvwlpqynilvggclvkstsakdlgnvadayv
    newstsienvlkryrninavvpghgevgdkglllhtldllk
    

  • Chain 'p':
    No sequence available.