PDB entry 1bmc

View 1bmc on RCSB PDB site
Description: structure of a zinc metallo-beta-lactamase from bacillus cereus
Deposited on 1995-06-16, released 1996-08-28
The last revision prior to the SCOP 1.59 freeze date was dated 1996-08-28, with a file datestamp of 1996-08-28.
Experiment type: XRAY
Resolution: 2.5 Å
R-factor: 0.22
AEROSPACI score: 0.3 (click here for full SPACI score report)

Chains and heterogens:

  • Chain ' ':
    Domains in SCOP 1.59: d1bmc__

PDB Chain Sequences:

  • Chain ' ':
    Sequence, based on SEQRES records: (download)
    >1bmc_ (-)
    tviknetgtisisqlnknvwvhtelgsfngeavpsnglvlntskglvlvdsswddkltke
    liemvekkfqkrvtdviithahadriggiktlkergikahstaltaelakkngyeeplgd
    lqtvtnlkfgnmkvetfypgkghtednivvwlpqynilvggclvkstsakdlgnvadayv
    newstsienvlkryrninavvpghgevgdkglllhtldllk
    

    Sequence, based on observed residues (ATOM records): (download)
    >1bmc_ (-)
    tviknetgtisisqlnknvwvhtelpsnglvlntskglvlvdsswddkltkeliemvekk
    fqkrvtdviithahadriggiktlkergikahstaltaelakkngyeeplgdlqtvtnlk
    fgnmkvetfypgkghtednivvwlpqynilvggclvkstsakdlgnvadayvnewstsie
    nvlkryrninavvpghgevgdkglllhtldllk