PDB entry 1bmc

View 1bmc on RCSB PDB site
Description: structure of a zinc metallo-beta-lactamase from bacillus cereus
Class: hydrolase (acting in cyclic amides)
Keywords: hydrolase (acting in cyclic amides), antibiotic resistance, signal
Deposited on 1995-06-16, released 1996-08-28
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 2.5 Å
R-factor: 0.22
AEROSPACI score: 0.29 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: metallo-beta-lactamase
    Species: Bacillus cereus [TaxId:1396]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1bmca_
  • Heterogens: ZN, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1bmcA (A:)
    tviknetgtisisqlnknvwvhtelgsfngeavpsnglvlntskglvlvdsswddkltke
    liemvekkfqkrvtdviithahadriggiktlkergikahstaltaelakkngyeeplgd
    lqtvtnlkfgnmkvetfypgkghtednivvwlpqynilvggclvkstsakdlgnvadayv
    newstsienvlkryrninavvpghgevgdkglllhtldllk
    

    Sequence, based on observed residues (ATOM records): (download)
    >1bmcA (A:)
    tviknetgtisisqlnknvwvhtelpsnglvlntskglvlvdsswddkltkeliemvekk
    fqkrvtdviithahadriggiktlkergikahstaltaelakkngyeeplgdlqtvtnlk
    fgnmkvetfypgkghtednivvwlpqynilvggclvkstsakdlgnvadayvnewstsie
    nvlkryrninavvpghgevgdkglllhtldllk