PDB entry 1bmb

View 1bmb on RCSB PDB site
Description: grb2-sh2 domain in complex with kpfy*vnvef (pkf270-974)
Class: hormone/growth factor
Keywords: sh2 domain, signal transduction, adaptor protein, ras pathway, hormone/growth factor complex
Deposited on 1998-07-23, released 1998-07-29
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: XRAY
Resolution: 1.8 Å
R-factor: 0.187
AEROSPACI score: 0.52 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: protein (growth factor receptor bound protein 2)
    Species: Homo sapiens [TaxId:9606]
    Gene: GRB2
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1bmba_
  • Chain 'I':
    Compound: protein (pkf270-974)
    Species: synthetic, synthetic
    Database cross-references and differences (RAF-indexed):
    • PDB 1BMB (0-8)
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1bmbA (A:)
    mgspknyiemkphpwffgkiprakaeemlskqrhdgafliresesapgdfslsvkfgndv
    qhfkvlrdgagkyflwvvkfnslnelvdyhrstsvsrnqqiflrdieqvpqqptyvqalf
    dfd
    

    Sequence, based on observed residues (ATOM records): (download)
    >1bmbA (A:)
    kphpwffgkiprakaeemlskqrhdgafliresesapgdfslsvkfgndvqhfkvlrdga
    gkyflwvvkfnslnelvdyhrstsvsrnqqiflrdieq
    

  • Chain 'I':
    No sequence available.