PDB entry 1bma

View 1bma on RCSB PDB site
Description: benzyl methyl aminimide inhibitor complexed to porcine pancreatic elastase
Class: hydrolase/hydrolase inhibitor
Keywords: SERINE PROTEASE,Metal-binding, Protease, Secreted, Zymogen, HYDROLASE-HYDROLASE INHIBITOR complex
Deposited on 1995-05-01, released 1995-12-07
The last revision prior to the SCOPe 2.07 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 1.8 Å
R-factor: 0.192
AEROSPACI score: 0.51 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Chymotrypsin-like elastase family member 1
    Species: Sus scrofa [TaxId:9823]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P00772 (0-239)
      • conflict (65)
    Domains in SCOPe 2.07: d1bmaa_
  • Heterogens: CA, SO4, 0QH, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1bmaA (A:)
    vvggteaqrnswpsqislqyrsgsswahtcggtlirqnwvmtaahcvdreltfrvvvgeh
    nlnqnngteqyvgvqkivvhpywntddvaagydiallrlaqsvtlnsyvqlgvlpragti
    lannspcyitgwgltrtngqlaqtlqqaylptvdyaicssssywgstvknsmvcaggdgv
    rsgcqgdsggplhclvngqyavhgvtsfvsrlgcnvtrkptvftrvsayiswinnviasn