PDB entry 1bm9

View 1bm9 on RCSB PDB site
Description: replication terminator protein from bacillus subtilis
Class: DNA-binding protein
Keywords: DNA-binding protein, contrahelicase
Deposited on 1998-07-29, released 1999-01-06
The last revision prior to the SCOPe 2.06 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 2 Å
R-factor: 0.206
AEROSPACI score: 0.42 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: replication terminator protein
    Species: Bacillus subtilis [TaxId:1423]
    Gene: rtp
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d1bm9a_
  • Chain 'B':
    Compound: replication terminator protein
    Species: Bacillus subtilis [TaxId:1423]
    Gene: rtp
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d1bm9b_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1bm9A (A:)
    mkeekrsstgflvkqraflklymitmteqerlyglkllevlrsefkeigfkpnhtevyrs
    lhellddgilkqikvkkegaklqevvlyqfkdyeaaklykkqlkveldrckkliekalsd
    nf
    

    Sequence, based on observed residues (ATOM records): (download)
    >1bm9A (A:)
    eekrsstgflvkqraflklymitmteqerlyglkllevlrsefkeigfkpnhtevyrslh
    ellddgilkqikvkkegaklqevvlyqfkdyeaaklykkqlkveldrckkliekalsdnf
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1bm9B (B:)
    mkeekrsstgflvkqraflklymitmteqerlyglkllevlrsefkeigfkpnhtevyrs
    lhellddgilkqikvkkegaklqevvlyqfkdyeaaklykkqlkveldrckkliekalsd
    nf
    

    Sequence, based on observed residues (ATOM records): (download)
    >1bm9B (B:)
    eekrsstgflvkqraflklymitmteqerlyglkllevlrsefkeigfkpnhtevyrslh
    ellddgilkqikvkkegaklqevvlyqfkdyeaaklykkqlkveldrckkliekalsdnf