PDB entry 1bm8

View 1bm8 on RCSB PDB site
Description: DNA-binding domain of mbp1
Class: cell cycle
Keywords: cell cycle, cyclins, DNA synthesis, helix-turn-helix DNA-binding domain, multiwavelength anomalous diffraction, transcription factor
Deposited on 1998-07-29, released 1999-03-02
The last revision prior to the SCOPe 2.08 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: XRAY
Resolution: 1.71 Å
R-factor: 0.197
AEROSPACI score: 0.53 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: transcription factor mbp1
  Species: Saccharomyces cerevisiae [TaxId:4932]
  Database cross-references and differences (RAF-indexed):
  • Uniprot P39678 (0-98)
  Domains in SCOPe 2.08: d1bm8a_
• Heterogens: HOH

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1bm8A (A:)
  qiysarysgvdvyefihstgsimkrkkddwvnathilkaanfakakrtrilekevlketh
  ekvqggfgkyqgtwvplniakqlaekfsvydqlkplfdf