PDB entry 1bm5

View 1bm5 on RCSB PDB site
Description: the solution structure of a site-directed mutant (r111m) of human cellular retionic acid binding protein-type II, nmr, 31 structures
Class: retinoic-acid transport
Keywords: retinoic-acid transport, crabpii
Deposited on 1998-07-28, released 1999-01-13
The last revision prior to the SCOPe 2.03 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.02 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: cellular retinoic acid binding protein-type II
  Species: Homo sapiens [TaxId:9606]
  Database cross-references and differences (RAF-indexed):
  • Uniprot P29373 (0-136)
    • conflict (110)
  Domains in SCOPe 2.03: d1bm5a_

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1bm5A (A:)
  pnfsgnwkiirsenfeellkvlgvnvmlrkiavaaaskpaveikqegdtfyiktsttvrt
  teinfkvgeefeeqtvdgrpckslvkwesenkmvceqkllkgegpktswtmeltndgeli
  ltmtaddvvctrvyvre