PDB entry 1bm4

View 1bm4 on RCSB PDB site
Description: momlv capsid protein major homology region peptide analog
Class: Viral protein
Keywords: MOLONEY MURINE LEUKEMIA VIRUS CAPSID PROTEIN, MOMLV, MU-MLV, CAPSID, MHR, MAJOR HOMOLOGY REGION, Viral protein
Deposited on 1998-07-28, released 1998-08-05
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.03 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: protein (moloney murine leukemia virus capsid)
    Species: synthetic, synthetic
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9WJP4 (0-31)
      • mutation (0)
    Domains in SCOPe 2.07: d1bm4a_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1bm4A (A:)
    cakvkgitqgpnespsaflerlkeayrrytpy